PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010933936.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 335aa    MW: 38634.6 Da    PI: 4.921
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010933936.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.67e-55111401129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeelv +yLkkkv+++k++l +vike+d+y++ePwdL++  ++   e++ewyfFs++dkky+tg+r+nrat sg+Wkatg+dk+v
  XP_010933936.1  11 VPPGFRFHPTDEELVGYYLKKKVASQKIDL-DVIKEIDLYRIEPWDLQEwcRIGYeEQSEWYFFSHKDKKYPTGTRTNRATLSGFWKATGRDKAV 104
                     69****************************.9***************954544332566************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     ++ k++l+g++ktLvfykgrap+g+ktdW++heyrle
  XP_010933936.1 105 HD-KNKLIGMRKTLVFYKGRAPNGQKTDWIIHEYRLE 140
                     **.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-598160IPR003441NAC domain
PROSITE profilePS5100558.48611160IPR003441NAC domain
PfamPF023654.9E-2812139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MQVMDSMESC VPPGFRFHPT DEELVGYYLK KKVASQKIDL DVIKEIDLYR IEPWDLQEWC  60
RIGYEEQSEW YFFSHKDKKY PTGTRTNRAT LSGFWKATGR DKAVHDKNKL IGMRKTLVFY  120
KGRAPNGQKT DWIIHEYRLE SEENGPPQEE GWVVCRAFKK RPACPTRSVV DVWDSNYGYD  180
DPSRVRSSIV NPMEYLQMQP KSLLCKQETE LDHLNLLHSN QLFQLPQLES PSLPLVKQPS  240
LLSIATENED EEQTRSCNAI DKVTDWRALD KFVASQLSQE DRFSAERVVS DFGADNDSDM  300
ALLLLQSGRE EVGKLNGFLT SGEPECDIGI CVFEK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-50816112169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010933936.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9SL411e-143NAC37_ARATH; NAC domain-containing protein 37
TrEMBLF6GWP20.0F6GWP2_VITVI; Putative uncharacterized protein
STRINGVIT_04s0023g03110.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36253768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-132vascular related NAC-domain protein 1